PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v0659440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TCP
Protein Properties Length: 202aa    MW: 21297.3 Da    PI: 9.8049
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v0659440.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP112.94.6e-3545131288
              TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                      a+ +++++++hTkv+gR+RRvR++ +caar+F+L++eLG+ +d++tieWLl+ a+p+i++ tgt++ +a   ++++ sss+ ++s +
  Lj5g3v0659440.1  45 ATTTRSTKDRHTKVNGRGRRVRMPPLCAARIFQLTRELGHRSDGETIEWLLRHAEPSIIAVTGTGTVPAAPISTVAPSSSTPAPSVS 131
                      67899***********************************************************55555333333333333333322 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.3E-2950144IPR005333Transcription factor, TCP
PROSITE profilePS5136926.56851105IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MTSDLVIHPF PHPTTTTVAT AGTTTITTGT ASNSKAKLAV TRKPATTTRS TKDRHTKVNG  60
RGRRVRMPPL CAARIFQLTR ELGHRSDGET IEWLLRHAEP SIIAVTGTGT VPAAPISTVA  120
PSSSTPAPSV SCPVQAVSEV SAAGMGMGMF SVQPSCRLDL CQPAGMDYPA VSGYRNMPFT  180
ALLLQPATAA EENQQEQALS KQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004497526.13e-78PREDICTED: transcription factor TCP11
SwissprotQ9SJK72e-44TCP11_ARATH; Transcription factor TCP11
TrEMBLK7LZR41e-75K7LZR4_SOYBN; Uncharacterized protein
STRINGGLYMA13G20710.24e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.12e-42TCP family protein